PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_025014-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 368aa    MW: 41368.4 Da    PI: 7.0196
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_025014-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.74.2e-161462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l+ +++q G+g +W + ++++g++R++k+c++rw++yl
    NNU_025014-RA 14 KGPWSPEEDAKLKAYIEQNGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding37.45.8e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++eEd ++  +    G++ W+ Ia+ ++ gRt++++k++w++
    NNU_025014-RA  69 GGFSEEEDNIICSLYISIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.162962IPR017930Myb domain
SuperFamilySSF466896.27E-2611109IPR009057Homeodomain-like
SMARTSM007173.9E-121364IPR001005SANT/Myb domain
PfamPF002499.4E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.1E-241569IPR009057Homeodomain-like
CDDcd001677.82E-91662No hitNo description
PROSITE profilePS5129421.66663117IPR017930Myb domain
SMARTSM007174.8E-1167115IPR001005SANT/Myb domain
PfamPF002491.4E-1069111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-2370117IPR009057Homeodomain-like
CDDcd001675.72E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDAKLKAYIE QNGTGGNWIA LPQKIGLKRC GKSCRLRWLN  60
YLRPNIKHGG FSEEEDNIIC SLYISIGSRW SIIAAQLPGR TDNDIKNYWN TRLKKKLLGK  120
QRKEQNARRV NSLKQEMKKG NGNNPIAVSA AESSNQLQNP YWPDLPMPVF MPCQNQDPHL  180
IISDNASLRK LLINKLGAGG RFSDGDGHHQ QPSDEGMNFQ CPLDIPSTQQ QLYENSINLL  240
PCHDQGPSLS NNTTCQWTDA QNQYGMDVAS MHILQGLNST TFPVVELDQI VYHHNSQTQR  300
LEGLEFYNGA GVMVNDSTWT SSAESSSWGD INSLVYPHLV THNYESREQA VLQLQECPLE  360
ESRYIGPQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-23141177108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010245646.10.0PREDICTED: transcription factor RAX3
TrEMBLD7UEC51e-135D7UEC5_VITVI; Putative uncharacterized protein
STRINGVIT_00s1352g00010.t011e-134(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49690.12e-80myb domain protein 84